PDB entry 4i4e

View 4i4e on RCSB PDB site
Description: Structure of Focal Adhesion Kinase catalytic domain in complex with hinge binding pyrazolobenzothiazine compound.
Class: transferase/transferase inhibitor
Keywords: Phosphorylated on tyrosines, transferase, Cytoplasmic; localized to focal adhesions, transferase-transferase inhibitor complex
Deposited on 2012-11-27, released 2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.166
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4i4ea_
  • Heterogens: 1BQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i4eA (A:)
    gamgsstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvr
    ekflqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslil
    yayqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklp
    ikwmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmpp
    ncpptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i4eA (A:)
    dyeiqrerielgrcigegqfgdvhqgiymspnpalavaiktcknctsdsvrekflqealt
    mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
    ayleskrfvhrdiaarnvlvssndcvklgdflpikwmapesinfrrftsasdvwmfgvcm
    weilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprftel
    kaqlstileeekaq