PDB entry 4i43

View 4i43 on RCSB PDB site
Description: Crystal structure of Prp8:Aar2 complex
Class: splicing
Keywords: spliceosome, U5 snRNP, Prp8, Reverse Transcriptase, Aar2, Endonuclease, RNase H, Jab1/MPN, pre-mRNA splicing, SPLICING
Deposited on 2012-11-27, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A1 cistron-splicing factor AAR2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: AAR2, YBL074C, YBL06.06, YBL0611
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i43a1, d4i43a2
  • Chain 'B':
    Compound: Pre-mRNA-splicing factor 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2, YHR165C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33334 (35-End)
      • expression tag (32-34)
    Domains in SCOPe 2.07: d4i43b1, d4i43b2, d4i43b3, d4i43b4, d4i43b5
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i43A (A:)
    mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
    dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
    vqmdkirkivrkdenqfsyvdssmttvqenellksslqkagskmeakneddpahslnytv
    infksreairpghemedfldksyylntvmlqgifknssnyfgelqfaflnamffgnygss
    lqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervwniclyssfqkn
    slhntekimenkypellgkdneddaliygisdeerddeddehnptivgglyyqrpaagkv
    argsrsgsenlyfqgshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i43A (A:)
    ntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywfd
    crmgnfyiqydpkdglykmmeerdgakfenirqmmvsypkideddtwynltefvqmdkir
    kivrkdenqfsyvdssmttvqenellkssleakneddpahslnytvinfksreairpghe
    medfldksyylntvmlqgifknssnyfgelqfaflnamffgnygsslqwhamielicssa
    tvpkhmldkldeilyyqiktlpeqysdillnervwniclyssfqknslhntekimenkyp
    ellgkdnddaliygddeddehnptivgglyyqrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i43B (B:)
    marakrrwkknfiavsaanrfkkisssgalgsgsgvmvewlesrsfspipfppltykndt
    kilvlaledlkdvyaskvrlnasereelalieeaydnphdtlnrikkylltqrvfkpvdi
    tmmenyqnispvysvdplekitdayldqylwyeadqrklfpnwikpsdseippllvykwt
    qginnlseiwdvsrgqsavllettlgemaekidftllnrllrlivdpniadyitaknnvv
    infkdmshvnkyglirglkfasfifqyyglvidllllgqeratdlagpannpnefmqfks
    kevekahpirlytryldriymlfhfeedegeeltdeylaenpdpnfensigynnrkcwpk
    dsrmrlirqdvnlgravfweiqsrvptsltsikwenafvsvysknnpnllfsmcgfevri
    lprqrmeevvsndegvwdlvdertkqrtakaylkvseeeikkfdsrirgilmasgsttft
    kvaakwntslislftyfreaivateplldilvkgetriqnrvklglnskmptrfppavfy
    tpkelgglgmisashilipasdlswskqtdtgithfragmthedekliptifryittwen
    efldsqrvwaeyatkrqeaiqqnrrlafeelegswdrgipristlfqrdrhtlaydrghr
    irrefkqyslernspfwwtnshhdgklwnlnayrtdviqalggietilehtlfkgtgfns
    weglfwekasgfedsmqfkklthaqrtglsqipnrrftlwwsptinranvyvgflvqldl
    tgiflhgkiptlkisliqifrahlwqkihesivfdicqildgeldvlqiesvtketvhpr
    ksykmnssaaditmesvhewevskpsllhetndsfkglitnkmwfdvqlrygdydshdis
    ryvrakfldyttdnvsmypsptgvmigidlaynmydaygnwfnglkpliqnsmrtimkan
    palyvlrerirkglqiyqssvqepflnssnyaelfnndiklfvddtnvyrvtvhktfegn
    vatkaingciftlnpktghlflkiihtsvwagqkrlsqlakwktaeevsalvrslpkeeq
    pkqiivtrkamldplevhmldfpniairptelrlpfsaamsidklsdvvmkatepqmvlf
    niyddwldrissytafsrltlllralktneesakmillsdptitiksyhlwpsftdeqwi
    tiesqmrdlilteygrkynvnisaltqteikdiilgqnikapsvkrqkmaeleaarsekq
    ndeeaagastvmktktinaqgeeivvvasadyesqtfssknewrksaiantllylrlkni
    yvsaddfveeqnvyvlpknllkkfieisdvkiqvaafiygmsakdhpkvkeiktvvlvpq
    lghvgsvqisnipdigdlpdteglellgwihtqteelkfmaasevathsklfadkkrdci
    disifstpgsvslsaynltdegyqwgeenkdimnvlsegfeptfsthaqlllsdritgnf
    iipsgnvwnytfmgtafnqegdynfkygiplefynemhrpvhflqfselagdeeleaeqi
    dvfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i43B (B:)
    gsgvmvewlesrsfspipfppltykndtkilvlaledlkdvyaskvrlnasereelalie
    eaydnphdtlnrikkylltqrvfkpvditpvysvdplekitdayldqylwyeadqrklfp
    nwikpsdseippllvykwtqginnlseiwdvsrgqsavllettlgemaekidftllnrll
    rlivdpniadyitaknnvvinfkdmshvnkyglirglkfasfifqyyglvidllllgqer
    atdlagpannpnefmqfkskevekahpirlytryldriymlfhfeedegeeltdeylaen
    pdpnfensigynnrkcwpkdsrmrlirqdvnlgravfweiqsrvptsltsikwenafvsv
    ysknnpnllfsmcgfevrilprqrmeendegvwdlvdertkqrtakaylkvseeeikkfd
    srirgilmasttftkvaakwntslislftyfreaivateplldilvkgetriqnrvklgl
    nskmptrfppavfytpkelgglgmisashilipasdlswskqtdtgithfragmthedek
    liptifryittwenefldsqrvwaeyatkrqeaiqqnrrlafeelegswdrgipristlf
    qrdrhtlaydrghrirrefkqyslernspfwwtnshhdgklwnlnayrtdviqalggiet
    ilehtlfkgtgfnsweglfwlsqipnrrftlwwsptinranvyvgflvqldltgiflhgk
    iptlkisliqifrahlwqkihesivfdicqildgeldvlqiesvtketvhprksykmnss
    aaditmesvhewevskpsllhetndsfkglitnkmwfdvqlrygdydshdisryvrakfl
    dyttdnvsmypsptgvmigidlaynmydaygnwfnglkpliqnsmrtimkanpalyvlre
    rirkglqiyqepflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingcift
    lnpktghlflkiihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkaml
    dplevhmldfpniairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldriss
    ytafsrltlllralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilt
    eygrkynvnisaltqtessknewrksaiantllylrlkniyvsaddfveeqnvyvlpknl
    lkkfieisdvkiqvaafiygmsakdhpkvkeiktvvlvpqlghvgsvqisnipdigdlpd
    teglellgwihtqteelkfmaasevathsklfadkkrdcidisifstpgsvslsaynltd
    egyqwgeenkdimnvlsegfeptfsthaqlllsdritgnfiipsgnvwnytfmgtafnqe
    gdynfkygiplefynemhrpvhflqfs