PDB entry 4i41

View 4i41 on RCSB PDB site
Description: Crystal Structure of human Ser/Thr kinase Pim1 in complex with mitoxantrone
Class: transferase/transferase inhibitor
Keywords: Ser/Thr kinase, mitoxantrone, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-27, released 2013-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4i41a_
  • Heterogens: MIX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i41A (A:)
    gphmkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngt
    rvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeela
    rsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgt
    rvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecq
    hlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i41A (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh