PDB entry 4i3i

View 4i3i on RCSB PDB site
Description: Structures of IT intermediate of photoactive yellow prtein E46Q muntant from time-resolved laue crystallography collected at 14ID APS
Class: luminescent protein
Keywords: photoreceptor, chromophore, photoreceptor protein, receptor, sensory transduction, luminescent protein
Deposited on 2012-11-26, released 2013-03-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.147
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • engineered mutation (45)
    Domains in SCOPe 2.03: d4i3ia_
  • Heterogens: HC4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i3iA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv