PDB entry 4i3c

View 4i3c on RCSB PDB site
Description: Crystal structure of fluorescent protein UnaG N57Q mutant
Class: fluorescent protein
Keywords: Fluorescent protein, Bilirubin binding protein, Lipocalin, Beta barrel, Cytosol
Deposited on 2012-11-26, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.154
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bilirubin-inducible fluorescent protein UnaG
    Species: Anguilla japonica [TaxId:7937]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DM59 (0-138)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d4i3ca_
  • Chain 'B':
    Compound: Bilirubin-inducible fluorescent protein UnaG
    Species: Anguilla japonica [TaxId:7937]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DM59 (0-138)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d4i3cb_
  • Heterogens: BLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4i3cA (A:)
mvekfvgtwkiadshnfgeylkaigapkelsdggdattptlyisqkdgdkmtvkieqgpp
tfldtqvkfklgeefdefpsdrrkgvksvvnlvgeklvyvqkwdgkettyvreikdgklv
vtltmgdvvavrsyrrate

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4i3cB (B:)
mvekfvgtwkiadshnfgeylkaigapkelsdggdattptlyisqkdgdkmtvkieqgpp
tfldtqvkfklgeefdefpsdrrkgvksvvnlvgeklvyvqkwdgkettyvreikdgklv
vtltmgdvvavrsyrrate