PDB entry 4i2u

View 4i2u on RCSB PDB site
Description: Crystal structure of the reduced glutaredoxin from Chlorella sorokiniana T-89 in complex with glutathione
Class: oxidoreductase
Keywords: cell redox homeostasis, Thioredoxin fold, Oxidoreductase, Glutathione Binding
Deposited on 2012-11-23, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.142
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Chlorella sorokiniana [TaxId:3076]
    Gene: grx
    Database cross-references and differences (RAF-indexed):
    • PDB 4I2U
    Domains in SCOPe 2.03: d4i2ua_
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i2uA (A:)
    msaakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqd
    ylleltggrsvprvfidgqfigggddtdalarngklevmlrnagvllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2uA (A:)
    saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
    lleltggrsvprvfidgqfigggddtdalarngklevmlrnagvllehh