PDB entry 4i2t

View 4i2t on RCSB PDB site
Description: Crystal structure of the oxidized glutaredoxin from Chlorella sorokiniana T-89
Class: oxidoreductase
Keywords: cell redox homeostasis, Thioredoxin fold, Oxidoreductase, Glutathione Binding
Deposited on 2012-11-22, released 2013-11-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.182
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Chlorella sorokiniana [TaxId:3076]
    Gene: grx
    Database cross-references and differences (RAF-indexed):
    • PDB 4I2T
    Domains in SCOPe 2.04: d4i2ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i2tA (A:)
    msaakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqd
    ylleltggrsvprvfidgqfigggddtdalarngklevmlrnagvllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2tA (A:)
    saakqlvdstisgnkvvifsktycpycvkgkralekflpkskitaieldgrndgaaiqdy
    lleltggrsvprvfidgqfigggddtdalarngklevmlrnagvlleh