PDB entry 4i2j

View 4i2j on RCSB PDB site
Description: Binary complex of mouse TdT with dCTP
Class: transferase
Keywords: Terminal transferase, TRANSFERASE
Deposited on 2012-11-21, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotidylexotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: DNTT, TDT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i2ja1, d4i2ja2, d4i2ja3
  • Heterogens: DCP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i2jA (A:)
    mgsshhhhhhssglvprgshmspspvpgsqnvpapavkkisqyacqrrttlnnynqlftd
    aldilaendelrenegsclafmrassvlkslpfpitsmkdtegipclgdkvksiiegiie
    dgesseakavlnderyksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqk
    agflyyedlvscvnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflits
    peatedeeqqllhkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkl
    dhgrvhseksgqqegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkm
    mldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2jA (A:)
    kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
    kdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwfr
    mgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdalv
    tmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfekf
    kqpdaldhfqkcflilkldhgrvhsekgkgwkairvdlvmcpydrrafallgwtgsrqfe
    rdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna