PDB entry 4i2b

View 4i2b on RCSB PDB site
Description: Ternary complex of mouse TdT with ssDNA and AMPcPP
Class: transferase/DNA
Keywords: Terminal transferase, TRANSFERASE-DNA complex
Deposited on 2012-11-21, released 2013-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotidylexotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: DNTT, TDT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4i2ba1, d4i2ba2, d4i2ba3
  • Chain 'C':
    Compound: 5'-d(p*ap*ap*ap*ap*a)-3'
  • Heterogens: NA, MG, APC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i2bA (A:)
    mgsshhhhhhssglvprgshmspspvpgsqnvpapavkkisqyacqrrttlnnynqlftd
    aldilaendelrenegsclafmrassvlkslpfpitsmkdtegipclgdkvksiiegiie
    dgesseakavlnderyksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqk
    agflyyedlvscvnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflits
    peatedeeqqllhkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkl
    dhgrvhseksgqqegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkm
    mldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2bA (A:)
    kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
    kdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwfr
    mgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdalv
    tmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfekf
    kqpsrkvdaldhfqkcflilkldhgrvhsekqegkgwkairvdlvmcpydrrafallgwt
    gsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

  • Chain 'C':
    No sequence available.