PDB entry 4i27

View 4i27 on RCSB PDB site
Description: Ternary complex of mouse TdT with ssDNA and incoming nucleotide
Class: transferase/DNA
Keywords: Terminal transferase, TRANSFERASE-DNA complex
Deposited on 2012-11-21, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotidylexotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: DNTT, TDT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i27a1, d4i27a2, d4i27a3
  • Chain 'C':
    Compound: 5'-d(*ap*ap*ap*ap*ap*t)-3'
  • Heterogens: MG, D3T, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i27A (A:)
    mgsshhhhhhssglvprgshmspspvpgsqnvpapavkkisqyacqrrttlnnynqlftd
    aldilaendelrenegsclafmrassvlkslpfpitsmkdtegipclgdkvksiiegiie
    dgesseakavlnderyksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqk
    agflyyedlvscvnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflits
    peatedeeqqllhkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkl
    dhgrvhseksgqqegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkm
    mldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i27A (A:)
    avkkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpi
    tsmkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaek
    wfrmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpd
    alvtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestf
    ekfkqpsaldhfqkcflilkldhgrvhseksgqqegkgwkairvdlvmcpydrrafallg
    wtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwern
    a
    

  • Chain 'C':
    No sequence available.