PDB entry 4i24

View 4i24 on RCSB PDB site
Description: Structure of T790M EGFR kinase domain co-crystallized with dacomitinib
Class: transferase
Keywords: Kinase domain, Phosphotrasfer, ATP binding, TRANSFERASE
Deposited on 2012-11-21, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
    Domains in SCOPe 2.07: d4i24a_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
    Domains in SCOPe 2.07: d4i24b_
  • Heterogens: 1C9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i24A (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i24A (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelankeildeayvm
    asvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakgmn
    yledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriythqsdvws
    ygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrp
    kfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i24B (B:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i24B (B:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgkvpikwmalesilhri
    ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkc
    wmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddv
    vdad