PDB entry 4i22

View 4i22 on RCSB PDB site
Description: Structure of the monomeric (V948R)gefitinib/erlotinib resistant double mutant (L858R+T790M) EGFR kinase domain co-crystallized with gefitinib
Class: transferase
Keywords: Kinase domain, Phosphotrasfer, ATP binding, TRANSFERASE
Deposited on 2012-11-21, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
      • engineered mutation (164)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d4i22a_
  • Heterogens: IRE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i22A (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i22A (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrkankeildeay
    vmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakg
    mnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllvpikwmalesilhriythqsdv
    wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmidads
    rpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad