PDB entry 4i1q

View 4i1q on RCSB PDB site
Description: Crystal Structure of hBRAP1 N-BAR domain
Class: cell adhesion
Keywords: N-BAR MEMBRANE BINDING DOMAIN, PIX and Endophilin A2, CELL ADHESION
Deposited on 2012-11-21, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bridging integrator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBW5 (Start-220)
      • see remark 999 (30)
    Domains in SCOPe 2.06: d4i1qa_
  • Chain 'B':
    Compound: bridging integrator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBW5 (Start-220)
      • see remark 999 (30)
    Domains in SCOPe 2.06: d4i1qb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i1qA (A:)
    gskfsraqekvlqklgkavetkderfeqsannfyqqqaeghklykdlknflsavkvmhes
    skrvsetlqeiyssewdgheelkaivwnndllwedyeekladqavrtmeiyvaqfseike
    riakrgrklvdydsarhhleavqnakkkdeaktakaeeefnkaqtvfedlnqelleelpi
    lynsrigcyvtifqnisnlrdvfyremsklnhnlyevmskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1qA (A:)
    kderfeqsannfyqqqaeghklykdlknflsavkvmhesskrvsetlqeiyssewdghee
    lkaivwnndllwedyeekladqavrtmeiyvaqfseikeriakrgrklvdydsarhhlea
    vqnakkkdeaktakaeeefnkaqtvfedlnqelleelpilynsrigcyvtifqnisnlrd
    vfyremsklnhnlyevmskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i1qB (B:)
    gskfsraqekvlqklgkavetkderfeqsannfyqqqaeghklykdlknflsavkvmhes
    skrvsetlqeiyssewdgheelkaivwnndllwedyeekladqavrtmeiyvaqfseike
    riakrgrklvdydsarhhleavqnakkkdeaktakaeeefnkaqtvfedlnqelleelpi
    lynsrigcyvtifqnisnlrdvfyremsklnhnlyevmskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1qB (B:)
    erfeqsannfyqqqaeghklykdlknflsavkvmhesskrvsetlqeiyssewdgheelk
    aivwnndllwedyeekladqavrtmeiyvaqfseikeriakrgrklvdydsarhhleavq
    nakkkdeaktakaeeefnkaqtvfedlnqelleelpilynsrigcyvtifqnisnlrdvf
    yremsklnhnlyevmskl