PDB entry 4i0v

View 4i0v on RCSB PDB site
Description: Crystal structure of Synechococcus sp. PCC 7002 globin at cryogenic temperature with heme modification
Class: unknown function
Keywords: hemeprotein, 2/2 hemoglobin, glbN, trhbN, 2/2 globin, ROS/RNS detoxification, UNKNOWN FUNCTION
Deposited on 2012-11-19, released 2012-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.188
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4i0va_
  • Chain 'B':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4i0vb_
  • Chain 'C':
    Compound: Cyanoglobin
    Species: Synechococcus sp. [TaxId:32049]
    Gene: glbN, SYNPCC7002_A1621
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4i0vc_
  • Heterogens: HEB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i0vA (A:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i0vB (B:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i0vC (C:)
    aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
    pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
    lnr