PDB entry 4i0s

View 4i0s on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase complexed with 2-(6-Chloro-1-methyl-1H-indazol-3-yl)-5H-pyrrolo[2,3-b]pyrazine-7-carboxylic acid isopropylamide
Class: transferase/transferase inhibitor
Keywords: kinase inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-19, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d4i0sa1, d4i0sa2
  • Heterogens: 1B5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i0sA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i0sA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqld
    npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
    nfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfssk
    sdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtyd
    venrpgfaavelrlrnyyydvvneghh