PDB entry 4i0c

View 4i0c on RCSB PDB site
Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme
Class: immune system/hydrolase
Keywords: beta-barrel, alpha-beta protein, immune recognition, glycosidase, IMMUNE SYSTEM-HYDROLASE complex
Deposited on 2012-11-16, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4i0ca_
  • Chain 'B':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4i0cb_
  • Chain 'C':
    Compound: cAbHuL5 antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I0C
    Domains in SCOPe 2.06: d4i0cc1, d4i0cc2
  • Chain 'D':
    Compound: cAbHuL5 antibody
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I0C (0-End)
    Domains in SCOPe 2.06: d4i0cd1, d4i0cd2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i0cA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i0cB (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i0cC (C:)
    qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
    svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
    qvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i0cC (C:)
    vqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyads
    vkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgtq
    vtvssh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4i0cD (D:)
    qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
    svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
    qvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i0cD (D:)
    qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
    svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
    qvtvssh