PDB entry 4i0b

View 4i0b on RCSB PDB site
Description: structure of the mutant Catabolite gene activator protein H160L
Class: transcription
Keywords: DNA binding, TRANSCRIPTION
Deposited on 2012-11-16, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (171)
    Domains in SCOPe 2.07: d4i0ba1, d4i0ba2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (171)
    Domains in SCOPe 2.07: d4i0bb1, d4i0bb2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i0bA (A:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldvtgriaqtllnlakqpdamtlpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i0bA (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamtlpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i0bB (B:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldvtgriaqtllnlakqpdamtlpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i0bB (B:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamtlpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvyg