PDB entry 4i08

View 4i08 on RCSB PDB site
Description: Crystal structure of beta-ketoacyl-acyl carrier protein reductase (FabG) from Vibrio cholerae in complex with NADPH
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, Vibrio cholerae, FabG, Rossmann fold, beta-ketoacyl-acyl carrier protein reductase, short chain dehydrogenase, NADP(H), OXIDOREDUCTASE
Deposited on 2012-11-16, released 2012-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.153
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: Vibrio cholerae O1 [TaxId:243277]
    Gene: fabG, VC2021, VC_2021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQH7 (7-250)
      • expression tag (4-6)
    Domains in SCOPe 2.03: d4i08a_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: Vibrio cholerae O1 [TaxId:243277]
    Gene: fabG, VC2021, VC_2021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQH7 (7-250)
      • expression tag (4-6)
    Domains in SCOPe 2.03: d4i08b_
  • Heterogens: SO4, EDO, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i08A (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i08A (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvnggm
    ymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i08B (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i08B (B:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfiettkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvng
    gmymi