PDB entry 4i03

View 4i03 on RCSB PDB site
Description: Human MMP12 in complex with a PEG-linked bifunctional L-glutamate motif inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: selective carboxylate based MMP-12 bifunctional inhibitor, METZINCIN, Zinc protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-11-16, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.146
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: HME, MMP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4i03a_
  • Heterogens: ZN, CA, L88, GOL, PGO, DMS, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4i03A (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg