PDB entry 4i00

View 4i00 on RCSB PDB site
Description: Crystal structure of influenza A neuraminidase N3-H274Y complexed with zanamivir
Class: hydrolase/hydrolase inhibitor
Keywords: neuraminidase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-11-16, released 2013-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:489926]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9YN63 (1-387)
      • expression tag (0)
      • engineered mutation (194)
    Domains in SCOPe 2.05: d4i00a_
  • Heterogens: CA, ZMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i00A (A:)
    frpfksplplcpfrgffpfhkdnairlgenkdvivtrepyvscdndncwsfalaqgallg
    tkhsngtikdrtpyrslirfpigtapvlgnykeiciawsssscfdgkewmhvcmtgndnd
    asaqiiyggrmtdsikswrkdilrtqesecqcidgtcvvavtdgpaansadyrvywireg
    kiikyenvpktkiqyleecscyvdidvycicrdnwkgsnrpwmrinnetiletgyvcskf
    hsdtprpadpstmscdspsnvnggpgvkgfgfkagddvwlgrtvstsgrsgfeiikvteg
    winspnhvksitqtlvsnndwsgysgsfivkakdcfqpcfyvelirgrpnknddvswtsn
    sivtfcgldnepgsgnwpdgsnigfmpk