PDB entry 4hzw

View 4hzw on RCSB PDB site
Description: Crystal structure of influenza A neuraminidase N3 complexed with laninamivir
Class: hydrolase/hydrolase inhibitor
Keywords: Neuraminidase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-11-15, released 2013-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.138
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:489926]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9YN63 (1-387)
      • expression tag (0)
    Domains in SCOPe 2.05: d4hzwa_
  • Heterogens: CA, LNV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzwA (A:)
    frpfksplplcpfrgffpfhkdnairlgenkdvivtrepyvscdndncwsfalaqgallg
    tkhsngtikdrtpyrslirfpigtapvlgnykeiciawsssscfdgkewmhvcmtgndnd
    asaqiiyggrmtdsikswrkdilrtqesecqcidgtcvvavtdgpaansadyrvywireg
    kiikyenvpktkiqhleecscyvdidvycicrdnwkgsnrpwmrinnetiletgyvcskf
    hsdtprpadpstmscdspsnvnggpgvkgfgfkagddvwlgrtvstsgrsgfeiikvteg
    winspnhvksitqtlvsnndwsgysgsfivkakdcfqpcfyvelirgrpnknddvswtsn
    sivtfcgldnepgsgnwpdgsnigfmpk