PDB entry 4hzv

View 4hzv on RCSB PDB site
Description: The crystal structure of influenza A neuraminidase N3
Class: hydrolase
Keywords: Neuraminidase, HYDROLASE
Deposited on 2012-11-15, released 2013-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:489926]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9YN63 (1-387)
      • expression tag (0)
    Domains in SCOPe 2.05: d4hzva_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzvA (A:)
    frpfksplplcpfrgffpfhkdnairlgenkdvivtrepyvscdndncwsfalaqgallg
    tkhsngtikdrtpyrslirfpigtapvlgnykeiciawsssscfdgkewmhvcmtgndnd
    asaqiiyggrmtdsikswrkdilrtqesecqcidgtcvvavtdgpaansadyrvywireg
    kiikyenvpktkiqhleecscyvdidvycicrdnwkgsnrpwmrinnetiletgyvcskf
    hsdtprpadpstmscdspsnvnggpgvkgfgfkagddvwlgrtvstsgrsgfeiikvteg
    winspnhvksitqtlvsnndwsgysgsfivkakdcfqpcfyvelirgrpnknddvswtsn
    sivtfcgldnepgsgnwpdgsnigfmpk