PDB entry 4hzf

View 4hzf on RCSB PDB site
Description: structure of the wild type Catabolite gene Activator Protein
Class: transcription
Keywords: CAP dimer, DNA binding, TRANSCRIPTION
Deposited on 2012-11-15, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.197
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzfa1, d4hzfa2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzfb1, d4hzfb2
  • Heterogens: CMP, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hzfA (A:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzfA (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hzfB (B:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzfB (B:)
    ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
    figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
    ekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilk
    mledqnlisahgktivvygt