PDB entry 4hze

View 4hze on RCSB PDB site
Description: Crystal structure of human Arginase-2 complexed with inhibitor 9
Class: Hydrolase/Hydrolase Inhibitor
Keywords: metalloenzyme,alpha/beta fold, Hydrolase, Arginine metabolism, Manganese, Mitochondrion, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2012-11-15, released 2013-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hzea_
  • Chain 'B':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hzeb_
  • Chain 'C':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hzec_
  • Heterogens: MN, BEN, BME, X7A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzeA (A:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzeB (B:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzeC (C:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg