PDB entry 4hzd

View 4hzd on RCSB PDB site
Description: Crystal structure of Serine acetyltransferase in complex with Coenzyme A from Brucella abortus strain S19
Class: transferase
Keywords: Left handed beta-helical (LBH) domain, Cysteine biosynthesis, serine acetyltransferase, TRANSFERASE
Deposited on 2012-11-15, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzda_
  • Chain 'B':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzdb_
  • Heterogens: COA, MG, 15P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hzdA (A:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzdA (A:)
    agldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsa
    dilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwl
    ykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgv
    tlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvp
    ariigetgct
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hzdB (B:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzdB (B:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct