PDB entry 4hzc

View 4hzc on RCSB PDB site
Description: Crystal structure of Serine acetyltransferase from Brucella abortus strain S19
Class: transferase
Keywords: Cysteine biosynthesis, acetyltransferase, Left handed beta-helical (LBH) domain, Transferase
Deposited on 2012-11-15, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzca_
  • Chain 'B':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcb_
  • Chain 'C':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcc_
  • Chain 'D':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcd_
  • Chain 'E':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzce_
  • Chain 'F':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcf_
  • Chain 'G':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcg_
  • Chain 'H':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzch_
  • Chain 'I':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzci_
  • Chain 'J':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcj_
  • Chain 'K':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzck_
  • Chain 'L':
    Compound: CysE, serine acetyltransferase
    Species: Brucella abortus [TaxId:430066]
    Gene: BAbS19_I11940, CysE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzcl_
  • Heterogens: TRS, MG, CL, 15P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hzcA (A:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcA (A:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hzcB (B:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcB (B:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariige
    tgct
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hzcC (C:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcC (C:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hzcD (D:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcD (D:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hzcE (E:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcE (E:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    ssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariiget
    gct
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4hzcF (F:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcF (F:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hzcG (G:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcG (G:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    ggdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariigetg
    ct
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hzcH (H:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcH (H:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4hzcI (I:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcI (I:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gksgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariige
    tgct
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4hzcJ (J:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcJ (J:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariige
    tgct
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4hzcK (K:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcK (K:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hzcL (L:)
    msvrmsskvnagldqvdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhria
    erlghpdvsadilrqtfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfha
    iqthrlahwlykqgrkdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavv
    ednvsilhgvtlggtgkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksv
    phnvtvagvpariigetgctepsrvmdqmlgdgilehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzcL (L:)
    vdpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrq
    tfdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgr
    kdfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggt
    gkssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariig
    etgct