PDB entry 4hyi

View 4hyi on RCSB PDB site
Description: X-RAY Crystal structure of compound 40 bound to human chk1 kinase domain
Class: transferase/transferase inhibitor
Keywords: SERINE/THREONINE-PROTEIN KINASE CHK1 INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-13, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hyia_
  • Heterogens: GOL, 1AO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hyiA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hyiA (A:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnhe
    nvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgig
    ithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefh
    aepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhki
    lvenpsaritipdikkdrwynkplkkgak