PDB entry 4hyh

View 4hyh on RCSB PDB site
Description: X-RAY Crystal structure of compound 39 bound to human chk1 kinase domain
Class: transferase/transferase inhibitor
Keywords: SERINE/THREONINE-PROTEIN KINASE CHK1 INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-13, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hyha_
  • Heterogens: 1AM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hyhA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hyhA (A:)
    pfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkenikkeicinkmlnhenvvk
    fyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithr
    dikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
    dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
    psaritipdikkdrwynkplkkg