PDB entry 4hy0

View 4hy0 on RCSB PDB site
Description: Crystal structure of XIAP BIR3 with T3256336
Class: ligase/ligase inhibitor
Keywords: BIR3, Baculoviral IAP repeat-containing protein 4, Apoptotic suppressor. Inhibitor of caspase-3, -7 and -9., Interacts with SMAC and with PRSS25, XIAP, BIRC4, X-linked inhibitor of apoptosis, LIGASE-LIGASE INHIBITOR complex
Deposited on 2012-11-12, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0a_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0b_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0c_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0d_
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0e_
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0f_
  • Chain 'G':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0g_
  • Chain 'H':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hy0h_
  • Heterogens: ZN, 1AQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hy0A (A:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0A (A:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hy0B (B:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0B (B:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hy0C (C:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0C (C:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthslee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hy0D (D:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0D (D:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleec
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hy0E (E:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0E (E:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4hy0F (F:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0F (F:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsle
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hy0G (G:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0G (G:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsleec
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hy0H (H:)
    gplgsrsesdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyal
    gegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleecl
    vrtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hy0H (H:)
    tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
    edpweqhakwypgckylleqkgqeyinnihlthsle