PDB entry 4hx8

View 4hx8 on RCSB PDB site
Description: Structure of metal-free MNTR mutant E11K
Class: transcription
Keywords: winged helix-turn-helix, transcription regulator, transcription
Deposited on 2012-11-09, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: mntR, yqhN, BSU24520
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • engineered mutation (9)
    Domains in SCOPe 2.07: d4hx8a1, d4hx8a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: mntR, yqhN, BSU24520
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • engineered mutation (9)
    Domains in SCOPe 2.07: d4hx8b1, d4hx8b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hx8A (A:)
    ttpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hx8A (A:)
    smedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvlts
    kgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeedd
    arkkdlksiqkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hx8B (B:)
    ttpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hx8B (B:)
    psmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyeglvltskg
    kkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddar
    kkdlksiqkk