PDB entry 4hx1

View 4hx1 on RCSB PDB site
Description: Structure of HLA-A68 complexed with a tumor antigen derived peptide
Class: immune system
Keywords: HLA molecules, peptide presentation, IMMUNE SYSTEM
Deposited on 2012-11-09, released 2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1ELT0 (0-273)
      • conflict (272)
    Domains in SCOPe 2.05: d4hx1a1, d4hx1a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 9-mer peptide from Tyrosinase-related protein-2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hx1A (A:)
gshsmryfytsmsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqrmygcdvgpdgrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
rtdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgt
fqkwvavvvpsgqeqrytchvqheglpkpltlkw

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.