PDB entry 4hwt

View 4hwt on RCSB PDB site
Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor
Class: Ligase/Ligase Inhibitor
Keywords: aminoacyl-tRNA synthetase, protein-inhibitor complex, Ligase-Ligase Inhibitor complex
Deposited on 2012-11-08, released 2013-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine--tRNA ligase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: TARS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4hwta1, d4hwta2
  • Chain 'B':
    Compound: Threonine--tRNA ligase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: TARS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4hwtb1, d4hwtb2
  • Heterogens: ZN, 1B2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hwtA (A:)
    mardhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnif
    nsrlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfg
    vlhrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnl
    strpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqc
    atiqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggkwpfwlsp
    rqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqynfilvvge
    kekisgtvnirtrdnkvhgertisetierlqqlkefrskqaeeeflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwtA (A:)
    rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
    rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
    hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
    rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
    iqldfqlpirfnltyvsdkkrpvivhrailgsvermiailtenyggkwpfwlsprqvmvv
    pvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqynfilvvgekekisg
    tvnirtrdnkvhgertisetierlqqlkefrskqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hwtB (B:)
    mardhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnif
    nsrlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfg
    vlhrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnl
    strpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqc
    atiqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggkwpfwlsp
    rqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqynfilvvge
    kekisgtvnirtrdnkvhgertisetierlqqlkefrskqaeeeflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwtB (B:)
    rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
    rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
    hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
    rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
    iqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggkwpfwlsprq
    vmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqynfilvvgeke
    kisgtvnirtrdnkvhgertisetierlqqlkefrskqaeee