PDB entry 4hwo

View 4hwo on RCSB PDB site
Description: Crystal structure of E. coli Threonyl-tRNA synthetase bound to a novel inhibitor
Class: Ligase/Ligase Inhibitor
Keywords: aminoacyl-tRNA synthetase, protein-inhibitor complex, antibacterial, Ligase-Ligase Inhibitor complex
Deposited on 2012-11-08, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.185
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine--tRNA ligase
    Species: Escherichia coli [TaxId:83333]
    Gene: thrS, b1719, JW1709
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8M3 (2-402)
      • expression tag (403-410)
    Domains in SCOPe 2.06: d4hwoa1, d4hwoa2, d4hwoa3
  • Chain 'B':
    Compound: Threonine--tRNA ligase
    Species: Escherichia coli [TaxId:83333]
    Gene: thrS, b1719, JW1709
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hwob1, d4hwob2
  • Heterogens: ZN, 409, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hwoA (A:)
    mardhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmm
    drvlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefg
    schrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvk
    lstrpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawq
    cgtvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlap
    vqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdk
    evesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqleelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwoA (A:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqleelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hwoB (B:)
    mardhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmm
    drvlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefg
    schrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvk
    lstrpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawq
    cgtvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlap
    vqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdk
    evesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqleelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwoB (B:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkq