PDB entry 4hwk

View 4hwk on RCSB PDB site
Description: Crystal structure of human sepiapterin reductase in complex with sulfapyridine
Class: oxidoreductase/antibiotic
Keywords: Reductase, OXIDOREDUCTASE-ANTIBIOTIC complex
Deposited on 2012-11-08, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hwka_
  • Chain 'B':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hwkb_
  • Chain 'C':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hwkc_
  • Chain 'D':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hwkd_
  • Heterogens: NAP, SO4, GOL, SFY, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hwkA (A:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwkA (A:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hwkB (B:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwkB (B:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hwkC (C:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwkC (C:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hwkD (D:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwkD (D:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd