PDB entry 4hw7

View 4hw7 on RCSB PDB site
Description: Crystal structure of FMS kinase domain with a small molecular inhibitor, PLX647-OME
Class: transferase/transferase inhibitor
Keywords: CSF-1-R, FMS PROTO-ONCOGENE, C-FMS, CD115 antigen, Kinase, ATP-binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-07, released 2013-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R, FMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07333
      • engineered mutation (136)
      • engineered mutation (253)
      • engineered mutation (330)
    Domains in SCOPe 2.04: d4hw7a_
  • Heterogens: 64M

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hw7A (A:)
    mkkghhhhhhgqkpkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlga
    gafgkvveatafglgkedavlkvavkmlkstahadekealmselkimshlgqhenivnll
    gacthggpvlviteyctygdllnflrrkaeamlgpslspgqdpegldkedgrplelrdll
    hfssqvaqgmaflaskncihrdvaarnvlltnghvakigdfglardimndsnyivkgnar
    lpvkwmapesifdsvytvqsdvwsygillweifslglnpypgilvnskfyklvkdgyqma
    qpafapkniysimqacwalepthrptfqqitsflqeqaqedrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hw7A (A:)
    ptqlpynekwefprnnlqfgktlgagafgkvveatafglgkedavlkvavkmlkstahad
    ekealmselkimshlgqhenivnllgacthggpvlviteyctygdllnflrrkaeamlgp
    sgrplelrdllhfssqvaqgmaflaskncihrdvaarnvlltnghvakigdfglardimn
    dsnyivkgnarlpvkwmapesifdsvytvqsdvwsygillweifslglnpypgilvnskf
    yklvkdgyqmaqpafapkniysimqacwalepthrptfqqitsflqeqa