PDB entry 4hvx

View 4hvx on RCSB PDB site
Description: tRNA-guanine transglycosylase Y106F, C158V mutant in complex with queuine
Class: Transferase/Transferase Inhibitor
Keywords: substrate specificity, bacterial TGT, Transferase, guanine exchange enzyme, queuine, Transferase-Transferase Inhibitor complex
Deposited on 2012-11-07, released 2012-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • engineered mutation (105)
      • engineered mutation (157)
      • see remark 999 (311)
    Domains in SCOPe 2.08: d4hvxa_
  • Heterogens: ZN, GOL, QEI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hvxA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggfqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdevtpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvxA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggfqvmqseegvtfhmlspersieiqh
    llgsdivmafdevtpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgiqqgs
    vfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmgvgkp
    ddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechcavcqk
    wsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfraryfa