PDB entry 4hvs

View 4hvs on RCSB PDB site
Description: Crystal structure of KIT kinase domain with a small molecule inhibitor, PLX647
Class: transferase/transferase inhibitor
Keywords: transferase, tyrosine-protein kinase, ATP-binding, kinase-kinase inhibitor complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-06, released 2013-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mast/stem cell growth factor receptor Kit
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT, SCFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721 (9-End)
      • expression tag (6-8)
      • engineered mutation (21)
      • engineered mutation (27)
      • engineered mutation (67)
      • engineered mutation (89)
      • engineered mutation (109)
      • engineered mutation (120)
      • engineered mutation (148-149)
      • engineered mutation (151-153)
      • engineered mutation (156)
      • engineered mutation (162)
      • engineered mutation (225)
      • engineered mutation (244)
      • engineered mutation (290)
      • engineered mutation (312)
      • engineered mutation (323)
    Domains in SCOPe 2.04: d4hvsa_
  • Heterogens: 647, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hvsA (A:)
    mghhhhhhmpmyevqwkvveesngnnysyidptqlpydhkwefprnrlsfgktlgagafg
    kvveataqgliksdaamtvavkmlkpsahsterealmselkvlsylgnhenivnllgact
    hggptlviteyccygdllnflrrkrdsfhssdtspasmeddenaldledllsfsyqvakg
    maflaskncihrdlaarnillthgritkicdfglardikndsnyvdkgnarlpvkwmape
    sifnsvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmsspehapaem
    ydimktcwdadpdkrptfkqivqdiekqisestnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvsA (A:)
    hhmpmyevqwkvveesngnnysyidptqlpydhkwefprnrlsfgktlgagafgkvveat
    aqgliksdaamtvavkmlkpsahsterealmselkvlsylgnhenivnllgacthggptl
    viteyccygdllnflrrkrdsfhssdtspasmeddenaldledllsfsyqvakgmaflas
    kncihrdlaarnillthgritkicdfglardikndsnyvdkgnarlpvkwmapesifnsv
    ytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmsspehapaemydimkt
    cwdadpdkrptfkqivqdiekqises