PDB entry 4hvr

View 4hvr on RCSB PDB site
Description: X-ray crystal structure of salicylic acid bound 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Class: oxidoreductase
Keywords: bi-cupin iron-binding, dioxygenase, OXIDOREDUCTASE
Deposited on 2012-11-06, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-hydroxyanthranilate 3,4-dioxygenase
  Species: Cupriavidus metallidurans [TaxId:266264]
  Gene: Cupriavidus metallidurans, nbaC, Rmet_5193
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1LCS4 (0-173)
  Domains in SCOPe 2.06: d4hvra_
• Heterogens: FE, SAL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hvrA (A:)
  mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
  qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
  fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa