PDB entry 4hvp

View 4hvp on RCSB PDB site
Description: structure of complex of synthetic hiv-1 protease with a stubtrate-based inhibitor at 2.3 angstroms resolution
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1989-08-08, released 1990-04-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • conflict (66)
    • conflict (94)
  Domains in SCOP 1.73: d4hvpa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • conflict (66)
    • conflict (94)
  Domains in SCOP 1.73: d4hvpb_
• Chain 'I':
  Compound: inhibitor
  
• Heterogens: ACE, NH2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hvpA (A:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hvpB (B:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'I':
  No sequence available.