PDB entry 4hvo

View 4hvo on RCSB PDB site
Description: 1.75 angstrom x-ray crystal structure of cufe reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans
Class: oxidoreductase
Keywords: bi-cupin iron-binding, dioxygenase, OXIDOREDUCTASE
Deposited on 2012-11-06, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:266264]
    Gene: Cupriavidus metallidurans, nbaC, Rmet_5193
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hvoa_
  • Heterogens: CU, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hvoA (A:)
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa