PDB entry 4hvk

View 4hvk on RCSB PDB site
Description: Crystal structure and functional studies of an unusual L-cysteine desulfurase from Archaeoglobus fulgidus.
Class: transferase
Keywords: Transferase and IscS, TRANSFERASE
Deposited on 2012-11-06, released 2012-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.11
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable cysteine desulfurase 2
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: AF0564, AF_0564, iscS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29689
      • see remark 999 (15)
    Domains in SCOPe 2.07: d4hvka_
  • Heterogens: CA, CL, PMP, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hvkA (A:)
    mayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvnggg
    gtvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipv
    gkygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgq
    ievdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsi
    vgfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyie
    gesivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvd
    rllevlpgvierlrsmsplyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvkA (A:)
    ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
    tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
    kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
    evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
    gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
    esivlsldmagiqastgqpshvlmacglkheeahgtllltlgryntdedvdrllevlpgv
    ierlrsmsp