PDB entry 4hvf

View 4hvf on RCSB PDB site
Description: Crystal structure of green fluorescent protein lanGFP(Branchiostoma Lanceolatum)
Class: fluorescent protein
Keywords: lanGFP, green fluorescent protein, beta-barrel, Gly-Tyr-Gly chromophore, Biomarker, cephalochordate, FLUORESCENT PROTEIN
Deposited on 2012-11-06, released 2013-09-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein blFP-Y6
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y6
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNB8 (9-227)
      • expression tag (8)
      • engineered mutation (9)
      • chromophore (65)
    Domains in SCOPe 2.03: d4hvfa_
  • Chain 'B':
    Compound: Green fluorescent protein blFP-Y6
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y6
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNB8 (9-227)
      • expression tag (8)
      • engineered mutation (9)
      • chromophore (65)
    Domains in SCOPe 2.03: d4hvfb_
  • Chain 'C':
    Compound: Green fluorescent protein blFP-Y6
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y6
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNB8 (9-227)
      • expression tag (8)
      • engineered mutation (9)
      • chromophore (65)
    Domains in SCOPe 2.03: d4hvfc_
  • Chain 'D':
    Compound: Green fluorescent protein blFP-Y6
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y6
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNB8 (9-227)
      • expression tag (1-8)
      • engineered mutation (9)
      • chromophore (65)
    Domains in SCOPe 2.03: d4hvfd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hvfA (A:)
    mhhhhhhgsllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwi
    lvpqigygfyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthi
    kgefqvigtgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnv
    rsnftfakpiaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvfA (A:)
    sllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigyg
    fyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvig
    tgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfak
    piaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hvfB (B:)
    mhhhhhhgsllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwi
    lvpqigygfyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthi
    kgefqvigtgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnv
    rsnftfakpiaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvfB (B:)
    sllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigyg
    fyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvig
    tgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfak
    piaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hvfC (C:)
    mhhhhhhgsllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwi
    lvpqigygfyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthi
    kgefqvigtgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnv
    rsnftfakpiaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvfC (C:)
    sllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigyg
    fyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvig
    tgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfak
    piaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hvfD (D:)
    mhhhhhhgsllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwi
    lvpqigygfyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthi
    kgefqvigtgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnv
    rsnftfakpiaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvfD (D:)
    hhhhhhgsllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwil
    vpqigygfyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthik
    gefqvigtgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvr
    snftfakpiaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm