PDB entry 4hvb

View 4hvb on RCSB PDB site
Description: Catalytic unit of PI3Kg in complex with PI3K/mTOR dual inhibitor PF-04979064
Class: transferase/transferase inhibitor
Keywords: Lipid kinase, kinase, phosphoinositide kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-11-05, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.276
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hvba1, d4hvba2, d4hvba3, d4hvba4
  • Heterogens: 19P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hvbA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hvbA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
    deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidip
    vlltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycl
    lyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnhpiar
    aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
    aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
    qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
    gtamlhdftqqvqviemlqkvtldikslsssqvisqlkqklenlqnsqlpesfrvpydpg
    lkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilri
    mesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhw
    lkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilg
    nyvpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmp
    qltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl