PDB entry 4hv6

View 4hv6 on RCSB PDB site
Description: Structure of MNTR H77A mutant in apo- and mn-bound forms
Class: transcription
Keywords: winged helix-turn-helix, transcription regulator, metalloregulator, transcription
Deposited on 2012-11-05, released 2012-11-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.252
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512 (0-End)
      • engineered mutation (75)
    Domains in SCOPe 2.03: d4hv6a1, d4hv6a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • engineered mutation (75)
    Domains in SCOPe 2.03: d4hv6b1, d4hv6b2
  • Heterogens: MN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hv6A (A:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyraelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hv6A (A:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyraelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hv6B (B:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyraelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hv6B (B:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvlt
    skgkkigkrlvyraelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeed
    darkkdlksiqkk