PDB entry 4hv5

View 4hv5 on RCSB PDB site
Description: Structure of the MNTR FE2+ complex with E site metal binding
Class: transcription
Keywords: winged helix-turn-helix, transcription regulator, transcription
Deposited on 2012-11-05, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: Bacillus subtilis, BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hv5a1, d4hv5a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: Bacillus subtilis, BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hv5b1, d4hv5b2
  • Heterogens: FE2, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hv5A (A:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hv5A (A:)
    smedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvltskgkk
    igkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddarkk
    dlksiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hv5B (B:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hv5B (B:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvltskgk
    kigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddark
    kdlksiq