PDB entry 4hue

View 4hue on RCSB PDB site
Description: Structure of 5-chlorouracil modified G:U base pair
Class: Hydrolase/DNA
Keywords: 5-chloro-2'-deoxyuridine, W-C base pair, wobble base pair, double helix, Wobble Base pairing pattern, Hydrolase-DNA complex
Deposited on 2012-11-02, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.194
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease H
  Species: Bacillus halodurans [TaxId:272558]
  Gene: rnhA, BH0863
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KEI9 (0-133)
    • engineered mutation (71)
  Domains in SCOPe 2.07: d4huea_
• Chain 'B':
  Compound: Ribonuclease H
  Species: Bacillus halodurans [TaxId:272558]
  Gene: rnhA, BH0863
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KEI9 (0-133)
    • engineered mutation (71)
  Domains in SCOPe 2.07: d4hueb_
• Chain 'C':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*tp*tp*(ucl)p*gp*cp*g)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*tp*tp*(ucl)p*gp*cp*g)-3')
  
• Chain 'E':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*tp*tp*(ucl)p*gp*cp*g)-3')
  
• Chain 'F':
  Compound: DNA (5'-d(*cp*gp*cp*gp*ap*ap*tp*tp*(ucl)p*gp*cp*g)-3')
  
• Heterogens: GOL, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hueA (A:)
  eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
  kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
  wqtdkwgeikadyg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hueB (B:)
  eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
  kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
  wqtdkwgeikadyg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.