PDB entry 4hua

View 4hua on RCSB PDB site
Description: E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue
Class: oxidoreductase
Keywords: 4r-fluoroproline, cisproline, thioredoxin fold, protein disulfide oxidoreductase activity, oxidoreductase
Deposited on 2012-11-02, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered mutation (33)
      • engineered mutation (39)
      • engineered mutation (63)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4huaa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4huaA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklni
    dqnagtaakygirgixtlllfkngevaatkvgalskgqlkefldanla