PDB entry 4htz

View 4htz on RCSB PDB site
Description: Crystal structure of PDE2 catalytic domain in space group P1
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-11-02, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4htza_
  • Chain 'B':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4htzb_
  • Chain 'C':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4htzc_
  • Chain 'D':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4htzd_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4htzA (A:)
    sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
    tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
    ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
    ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
    ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
    fpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4htzA (A:)
    ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
    larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
    dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
    dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
    trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
    pkaaelyervasnrehwtkvshkftirglpsnnsldfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4htzB (B:)
    sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
    tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
    ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
    ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
    ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
    fpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4htzB (B:)
    deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
    arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
    hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
    lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
    rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
    kaaelyervasnrehwtkvshkftirglpsnnsldfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4htzC (C:)
    sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
    tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
    ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
    ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
    ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
    fpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4htzC (C:)
    qpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvkkgy
    rdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsfqva
    sksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiilatdl
    ahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliykef
    fsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyervas
    nrehwtkvshkftirglpsnnsldf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4htzD (D:)
    sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
    tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
    ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
    ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
    ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
    fpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4htzD (D:)
    qpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvkkgy
    rdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsfqva
    sksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiilatdl
    ahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliykef
    fsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyervas
    nrehwtkvshkftirglpsnnsldfl