PDB entry 4hta

View 4hta on RCSB PDB site
Description: The structure of the karrikin insensitive (KAI2) protein in Arabidopsis thaliana
Class: hydrolase
Keywords: alpha/beta hydrolase, SIGNALING PROTEIN, HYDROLASE
Deposited on 2012-11-01, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, alpha/beta fold family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: F6G17.120, AT4G37470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SZU7
      • expression tag (10-13)
    Domains in SCOPe 2.07: d4htaa1, d4htaa2
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4htaA (A:)
    hhhhhhlestslykkagfmgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvd
    dyrvvlydnmgagttnpdyfdfdrysnlegysfdliailedlkiescifvghsvsamigv
    laslnrpdlfskivmisaspryvndvdyqggfeqedlnqlfeairsnykawclgfaplav
    ggdmdsiavqefsrtlfnmrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpv
    vvseylhanlgcesvvevipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4htaA (A:)
    slykgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagtt
    npdyfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivm
    isaspryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrt
    lfnmrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesv
    vevipsdghlpqlsspdsvipvilrhirndi