PDB entry 4ht1

View 4ht1 on RCSB PDB site
Description: Human TWEAK in complex with the Fab fragment of a neutralizing antibody
Class: immune system
Keywords: antibody Fab, TNF homology domain, cytokine, Tweak receptor, membrane bound, extracellular THD domain, IMMUNE SYSTEM
Deposited on 2012-10-31, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric antibody Fab
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HT1 (0-End)
  • Chain 'L':
    Compound: chimeric antibody Fab
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HT1 (0-End)
    Domains in SCOPe 2.07: d4ht1l1, d4ht1l2
  • Chain 'T':
    Compound: Tumor necrosis factor ligand superfamily member 12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >4ht1L (L:)
aiemtqtpfsvsaavggtvtincqasqniysnlawyqqkpgqppkllmytasylasgvps
rfkgsgsrteytltisgvqcadaatyycqtayynsrpdtvafgggtevvvkrtvaapsvf
ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
stltlskadyekhkvyacevthqglsspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >4ht1L (L:)
aiemtqtpfsvsaavggtvtincqasqniysnlawyqqkpgqppkllmytasylasgvps
rfkgsgsrteytltisgvqcadaatyycqtayynsrpdtvafgggtevvvkrtvaapsvf
ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
stltlskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'T':
    No sequence available.